npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

@holoscript/alphafold-plugin

v1.0.0

Published

AlphaFold protein structure prediction for HoloScript - Generate novel proteins in VR

Downloads

51

Readme

@holoscript/alphafold-plugin

AlphaFold protein structure prediction for HoloScript - Generate novel proteins in VR

npm version License: MIT

Features

  • 🧬 AlphaFold3 API Integration - Cloud-based protein structure prediction
  • 🔬 Local ColabFold Support - Run predictions on your own GPU
  • 🎨 pLDDT Confidence Coloring - Visualize prediction confidence in VR
  • 🧪 Multimer Prediction - Predict protein complexes (antibodies, etc.)
  • 📊 PAE Visualization - Predicted Aligned Error heatmaps
  • Batch Predictions - Compare multiple protein variants

Installation

npm install holoscript @holoscript/alphafold-plugin
pip install requests  # Python dependency

Quick Start

object "My Protein" @alphafold_predict @structure_confidence {
  sequence: "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVK",
  mode: "api",
  color_by: "confidence",
}

Documentation

See examples/protein-prediction.holo for comprehensive examples.

Requirements

  • Node.js: 18.0.0+
  • Python: 3.10+
  • AlphaFold3 API Key (for API mode) or ColabFold (for local mode)

License

MIT © HoloScript Contributors


Generated by: create-holoscript-plugin