npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

@mondaydotcomorg/tunnel-server

v0.1.6

Published

Monday Tunnel exposes your localhost to the world for easy testing and sharing! No need to mess with DNS or deploy just to have others test out your changes.

Maintainers

lior_bloch_arkislior_bloch_arkisyanivliyanivliinbalsl-mndyinbalsl-mndyluka-fritzscheluka-fritzschesagi-dahansagi-dahanidanlufidanlufitaysimonitaysimongiladmirongiladmironidosal-mndyidosal-mndyronykodronykodlinahaninlinahaninedenbarcocoedenbarcocodinportnoydinportnoytalmonetatalmonetaglivnatglivnatadiliadiliadarhadarhtomkaptomkapesty-yeesty-yeorief-mondayorief-mondaygrivosgrivosoleh_atlanovoleh_atlanovliorpo-npmliorpo-npmpazdepazdemaykishonmaykishonimriisaacsonimriisaacsondeanifdeanifomershaomershamatantesslermatantesslerrotemzmrotemzmmichalsz-mondaymichalsz-mondayalmogro-mondayalmogro-mondaybenjamintabenjamintaronshronshkerenbenariekerenbenarieidan-aharoniidan-aharoniarielyuarielyukarinbrkarinbryossi-ab-mondayyossi-ab-mondayshai_menachemshai_menachemrotemondayrotemondayanna_hyattanna_hyattbroster.mondaybroster.mondaydananodananoantoniopirontiantoniopirontishaharga4shaharga4roishroishorborochovichorborochovichtalahmondaytalahmondaynirfridnirfridmickaelbemickaelbetomer-asttomer-asteliorsieliorsijackstepnerjackstepnermoshekatz_mondaymoshekatz_mondaydavidbr1davidbr1roykulikroykulikorhayorhaytomer.mondaytomer.mondayitamargolditamargoldilyastoliarilyastoliaralexjialexjitomerbrtomerbradiraskanskyadiraskanskyhennassimyhennassimyrotemassa123rotemassa123moranrosenthalmondaymoranrosenthalmondayshanybarshanybarcmp-mondaycmp-mondayamirdana115amirdana115franciszekzafranciszekzavikas-monday-newvikas-monday-newmaciejlemaciejledanfishbeindanfishbeinyoavgalyoavgalgordonso-mdgordonso-mdsniryemndysniryemndyrotemzorotemzoamitrossamitrossnoasharvitnoasharvitasaf4722mondayasaf4722mondayori-morhaimori-morhaimgregragregraalonsaalonsanoamblanoamblaeladaveladaveffigoeffigonimrodadonimrodadoaviad_danizgeraviad_danizgermaciej-mondaymaciej-mondayarinaonmondayarinaonmondaydalyagreen1dalyagreen1yonisadowskyyonisadowskyrossgaskellmndyrossgaskellmndyamitleamitleguytaguytaamit-naamanamit-naamanoriblauoriblauinbalsainbalsakerenkokerenkojacky-mondayjacky-mondaycamrondaycamrondaymiguelfaasemiguelfaasesefinisefiniphumanphumannaamayeffetnaamayeffetrotemit34rotemit34liamjherbieliamjherbiedanielsagidanielsagidevorahfr-mondaydevorahfr-mondaynatbawnatbawbennyzibennyziohadsheferohadsheferdoronnadoronnamatbec96matbec96obinnaubobinnaubidofinderidofinderorybaorybaliangcaoldnliangcaoldnguygotguygotzivamzivamnoarenoaretsemach_lifshitztsemach_lifshitzfelixnpmfelixnpmdanielmildanielmilsasahstsasahstjberrzjberrzmonday-infra-adminmonday-infra-adminmonday-npm-publishermonday-npm-publisheryardenayyardenaymikolaj-kubikmikolaj-kubikdviryodviryoas-mondaydotcomas-mondaydotcomkarolchkarolchrobpmdrobpmdliorwaliorwaivanko5417mivanko5417mronco-mndyronco-mndynavelenaveleeyalleeyalledavidgrmondaydavidgrmondayrotem-tetuanirotem-tetuanipalinaka-mondaypalinaka-mondayavigail-hasida-mondayavigail-hasida-mondayassafliassaflierez-raerez-ranassimhanassimhadordubdordubomerpessachomerpessachomerkeomerkesagitufmansagitufmanmatkotmatkotjacekplonkajacekplonkadamianradamianraradekgradekgwojtek-grwojtek-grrafalbirafalbinattimondaynattimondaygiladsagiladsajakub-sulkowskijakub-sulkowskiamitmalihiamitmalihipiotrjapiotrjaruslan-mondayruslan-mondaylukaszwilukaszwiamirsiamirsiohad-mondayohad-mondayliora-mondayliora-mondayvakninrvakninrcountach88countach88arielb33arielb33chandraprjchandraprjayalastayalastoferme-mndyoferme-mndyamitshah-mondayamitshah-mondaymirondanmirondanalmogmondayalmogmondayahuvimahuvimavihaifeavihaifemoshe_crespinmoshe_crespinmithunramithunramilanba-mondevmilanba-mondevvdekhtvdekhtpatrykwopatrykwoprzemyslawstprzemyslawstalobachalobachgalgagalgalukaszda-mondaylukaszda-mondayalexanderpyalexanderpymaorkomaorkoshayfa-mondayshayfa-mondaynogakrnogakror-sternor-sternitayhaitayhajeeljojeeljoeitanoveitanovyampallaceyampallacemalkamamalkamakorengastkorengastofek-dayanofek-dayan

Keywords

Readme

Monday.com Tunnel Server

Monday Tunnel exposes your localhost to the world for easy testing and sharing! No need to mess with DNS or deploy just to have others test out your changes.

This package is the server component. If you are just looking for the CLI tunnel app, see (https://github.com/mondaycom/tunnel).

Overview

The default localtunnel client connects to the tunnel.monday.app server. You can, however, easily set up and run your own server. In order to run your own tunnel server you must ensure that your server can meet the following requirements:

  • You can set up DNS entries for your domain.tld and *.domain.tld (or sub.domain.tld and *.sub.domain.tld).
  • The server can accept incoming TCP connections for any non-root TCP port (i.e. ports over 1000).

The above are important as the client will ask the server for a subdomain under a particular domain. The server will listen on any OS-assigned TCP port for client connections.

Setup

npm install 

# server set to run on port 1234
mtunnel-server --port 1234

The localtunnel server is now running and waiting for client requests on port 1234. You will most likely want to set up a reverse proxy to listen on port 80 (or start localtunnel on port 80 directly).

NOTE By default, localtunnel will use subdomains for clients, if you plan to host your localtunnel server itself on a subdomain you will need to use the --domain option and specify the domain name behind which you are hosting localtunnel. (i.e. my-tunnel-server.example.com)

Usage

You can now use your domain with the --host flag for the mtunnel client.

mtunnel-server --host http://sub.example.tld:1234 --port 9000

You will be assigned a URL similar to heavy-puma-9.sub.example.com:1234.

If your server is acting as a reverse proxy (i.e. nginx) and is able to listen on port 80, then you do not need the :1234 part of the hostname for the mtunnel client.

REST API

POST /api/tunnels

Create a new tunnel with randomly selected name.

POST /api/tunnels/{id}

Create a new tunnel with your own subdomain (id). If that subdomain is already in use it will generate a random one.

GET /api/tunnels/{id}/status

Get number of connected sockets for a specific tunnel.

GET /api/status

General server information (number of tunnels, memory & CPU stats).

Deploy

You can deploy your own localtunnel server using the prebuilt docker image.

Note This assumes that you have a proxy in front of the server to handle the http(s) requests and forward them to the localtunnel server on port 3000. You can use our localtunnel-nginx to accomplish this.