npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

@ncbijs/fasta

v0.1.1

Published

Parse FASTA format sequences into typed records

Downloads

41

Readme

@ncbijs/fasta

Runtime: Browser + Node.js

Parse FASTA format sequences into typed records. Zero dependencies.

Installation

npm install @ncbijs/fasta

Usage

import { parseFasta } from '@ncbijs/fasta';

const text = `
>NP_000537.3 cellular tumor antigen p53 isoform a [Homo sapiens]
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP
DEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYPQGLNGTVNLPGRNSFEV
`;

const records = parseFasta(text);

console.log(records[0].id); // 'NP_000537.3'
console.log(records[0].description); // 'cellular tumor antigen p53 isoform a [Homo sapiens]'
console.log(records[0].sequence); // 'MEEPQSDPSVEPPLSQETFSDLWKLL...'

API

parseFasta(text: string): Array<FastaRecord>

Parses a FASTA-formatted string into an array of records.

  • Header lines (>) split into id (first word) and description (rest)
  • Multi-line sequences are concatenated
  • Comment lines (;) and blank lines are skipped
  • Handles GenBank, UniProt/SwissProt, and NCBI identifier formats

Error handling

parseFasta is a pure synchronous parser. It does not throw on malformed input — records without a header line (>) are silently skipped, and empty sequences produce records with an empty sequence string.

FastaRecord

interface FastaRecord {
  readonly id: string;
  readonly description: string;
  readonly sequence: string;
}