npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@nrk/svg-to-js

v3.0.1

Published

Module for concatenating SVG files into JavaScript

Downloads

254

Maintainers

hammeralfhammeralfjanerikbrjanerikbrthormodbthormodbsiiverssiiverstorsrextorsrexharaldskharaldskeskilgheskilghragnaroh-nrkragnaroh-nrkdaardaldaardalarevjensenarevjensenjulusianjulusianmadsernmadsernandrefauandrefaujfjeldskaarjfjeldskaarmuddahmuddahjensragejensrageoysteinkoppangoysteinkoppangphajsiphajsijorn_georgjorn_georgbjornhelsbjornhelshalvorhhalvorhmorten-nrkmorten-nrknicklassvendsrudnicklassvendsrudkjellvnnrkkjellvnnrksanderknrksanderknrknikolaianikolaiaeirikjstnrkeirikjstnrkcarinafraningcarinafraninghelenperhelenperstefanogdennrkstefanogdennrkjimmeloysundjimmeloysundtobiasrptobiasrpmartioskmartioskjimalexbergerjimalexbergergunderwondergunderwonderhamnishamnisluminrkluminrksupermeisensupermeisenvagifabilovvagifabilovclaudio-nrkclaudio-nrkhaakemonhaakemonzenangstzenangstrannveigncrannveignceschoieneschoienbaltebaltetoshbtoshbemte123emte123opetopetklizterkliztermikkelnygardmikkelnygardfeiringfeiringdervodevdervodevgrimburgrimburgardkroyergardkroyerkariaankariaanedplayzedplayzelias-chairielias-chairimiatollaksvikmiatollaksvikytterboytterbomachineboycommachineboycomtrulsltrulslmslhmmslhmcbjerkancbjerkanhermangudesenhermangudesenandreeldareideandreeldareidehenningkollerhenningkollerespenhalstensenespenhalstensendanjohnrkdanjohnrkolapeterolapeterteodor-elstadteodor-elstadlorecasterlorecasternrk-ps-teamcitynrk-ps-teamcityswlaswlanrk-midas-jenkinsnrk-midas-jenkinsandorpandorandorpandornrkrichardnrkrichardgesigesigundelsby-nrkgundelsby-nrkjonstalecarlsenjonstalecarlsennrk-sofie-cinrk-sofie-cinytaminnytaminjesperstarkarjesperstarkarskjalgepalgskjalgepalgeirikhalvardeirikhalvardastokkeastokken640071n640071n07073n07073henrik-mattssonhenrik-mattssonhaavardmhaavardmyryrnrk-kurator-jenkinsnrk-kurator-jenkinstorgeilotorgeilonrk-user-syncnrk-user-syncdhdeploydhdeployespenwaespenwaovstetunovstetunstianljstianljharaldkjharaldkjmariusumariusucristobalcristobalknuthaugknuthaugthohalvthohalvjohnarnejohnarneeshaswinieshaswinimorrowmorrowoyvindehoyvindehlaatlaattoggutoggunrk-jenkinsnrk-jenkinsplommaplommaevjandevjandmoltubakkmoltubakkingridgureningridgurenlu-luxlu-luxanderslianderslisiljesiljestiandgstiandgsjurlursjurlurandipodnrkandipodnrkpkejpkejyosrimtiyosrimtimorten.nyhaugmorten.nyhaugingvildcathingvildcatherlend.joneserlend.jonesbrneirikbrneirikmollersemollersetbnrktbnrknordankenordankesimonmitternachtsimonmitternachtmartintorgersenmartintorgersenrebchrrebchrsteipalsteipaldiscobusdiscobusmartingundersenmartingundersentinkajtstinkajtshallvardlidhallvardlidtomivartomivarajacoajacotobinustobinusmortenokmortenoknrk-ark-deploynrk-ark-deployjeangilbertlouisjeangilbertlouisheidimorkheidimorkingriddraageningriddraagenfridajalborgfridajalborgbruusibruusirosvollrosvollchristianeidechristianeideenordbyenordbyglen_imrieglen_imriemia.aasbakkenmia.aasbakkenelathamnaelathamnaevjjan17evjjan17olatoftolatoftkongsrudkongsrudchrpeterchrpeteringvildforsethingvildforsethharaldk76haraldk76stigokstigokjohannesodlandjohannesodlandanders993anders993vildefjvildefjvildepkvildepkrolerbolerrolerbolermeloyguttmeloyguttanders.baggethunanders.baggethun

Readme

@nrk/svg-to-js

Module for concatenating SVG files into JavaScript.

Why load icons as JavaScript?

SVG symbols are great for styling and accessibility, but can not load cross domain, or from external file and in IE (9,10,11). Javascript provides us a cacheable, cross-domain method to load the icons, without adding extra overhead to each html-file.

Installation

npm install @nrk/svg-to-js

Basic Usage

import svgtojs from '@nrk/svg-to-js'

const options = {
  input: 'src/',                      // Required. Folder with SVG files
  banner: 'Made with @nrk/svg-to-js', // Optional. Text to add as comment in top of file
  scale: 1,                           // Optional. Scale factor for width/height attributes in em

  // svgtojs always returns Object of outputs,
  // but can optionally also write files:
  esm: 'core-icons.esm.js',   // ES module for bundlers exposing `export const iconName = '<svg...'`
  cjs: 'core-icons.js',       // CommonJS for Node exposing `module.exports = { iconName: '<svg...' }`
  esmx: 'core-icons.esm.jsx', // JSX ES module, exposing React components with `export`
  cjsx: 'core-icons.cjs.jsx', // JSX CommonJS, exposing React components with `module.exports`
  iife: 'core-icons.min.js',   // Self executing <script>, exposing all icons as symbols on page,
  dts: 'core-icons.d.ts',     // Exposes typescript definitions with `export declare const`
  dtsx: 'core-icons-jsx.d.ts' // Exposes typescript definitions for JSX with `export declare const`
}

svgtojs(options)
// => Returns {
//  esm: String,
//  cjs: String,
//  esmx: String,
//  cjsx: String,
//  iife: String,
//  dts: String,
//  dtsx: String
//}

Using custom outputs

You can add custom outputs by providing the correct array of customOutputs. Each configuration is composed by these keys:

  • required parser: Callback to transform the contents of each svg in the config.input directory. An icon config object is provided as an argument (see example below).
  • optional filename: Output filename. If not present, no file is written, only config in return object
  • optional includeBanner: Include config.banner as comment in the first line of your output (file)
// Example of icon config object for nrk-close from @nrk/core-icons
{
  camelCase: 'nrkClose',
  titleCase: 'NrkClose',
  symbol: '<symbol viewBox="0 0 24 24" id="nrk-close" ><path fill="currentColor" fill-rule="evenodd" clip-rule="evenodd" d="M12 10.5858l6.2929-6.29289 1.4142 1.41421L13.4142 12l6.2929 6.2929-1.4142 1.4142L12 13.4142l-6.29288 6.2929-1.41421-1.4142L10.5858 12 4.29291 5.70712l1.41421-1.41421L12 10.5858z"/></symbol>',
  svg: '<svg viewBox="0 0 24 24" class="nrk-close" width="24.000em" height="24.000em"  aria-hidden="true" focusable="false"><path fill="currentColor" fill-rule="evenodd" clip-rule="evenodd" d="M12 10.5858l6.2929-6.29289 1.4142 1.41421L13.4142 12l6.2929 6.2929-1.4142 1.4142L12 13.4142l-6.29288 6.2929-1.41421-1.4142L10.5858 12 4.29291 5.70712l1.41421-1.41421L12 10.5858z"/></svg>',
  jsx: `var attributes = {'aria-hidden': true, width: '24.000em', height: '24.000em', viewBox: '0 0 24 24', dangerouslySetInnerHTML: {__html: '<path fill="currentColor" fill-rule="evenodd" clip-rule="evenodd" d="M12 10.5858l6.2929-6.29289 1.4142 1.41421L13.4142 12l6.2929 6.2929-1.4142 1.4142L12 13.4142l-6.29288 6.2929-1.41421-1.4142L10.5858 12 4.29291 5.70712l1.41421-1.41421L12 10.5858z"/>'}}\n` +
    '        if (props) Object.keys(props).forEach(function (key) { attributes[key] = props[key] })\n' +
    "        return React.createElement('svg', attributes)"
},

Generate svg strings with id-attributes

// Present in current directory (__dirname):
// nrk-bell.svg
// nrk-close-no-viewBox.svg
// nrk-close.svg
// nrk-download.svg

import svgtojs from '@nrk/svg-to-js'

const customOutputs = [{
  includeBanner: true,
  parser({ camelCase, titleCase, svg }) {
    return `export const ${camelCase} = '${svg.replace('<svg', `<svg id="${titleCase}"`)}';`
  },
  filename: 'id_output.js'
}]

const options = {
  banner: 'Made with @nrk/svg-to-js',
  input: __dirname,
  customOutputs: customOutputs
}

svgtojs(options)
// => Returns {
//  esm: String,
//  cjs: String,
//  esmx: String,
//  cjsx: String,
//  iife: String,
//  dts: String,
//  dtsx: String,
//  custom_1: String
//}

Generates custom output file id_output.js:

/** Made with @nrk/svg-to-js **/
export const nrkBell = '<svg id="NrkBell" viewBox="0 0 24 24" class="nrk-bell" width="24.000em" height="24.000em"  aria-hidden="true" focusable="false"><path fill="currentColor" fill-rule="evenodd" clip-rule="evenodd" d="M13 1h-2v1.05475C7.86324 2.40036 5 4.38211 5 8v8.5L3 18v2h18v-2l-2-1.5V8c0-3.61788-2.8632-5.59963-6-5.94525V1zm1 20H9.99999c0 1.1046.89541 2 2.00001 2s2-.8954 2-2zM11.9974 4h.0052c1.3984.00051 2.6978.40515 3.5978 1.09086C16.4454 5.73464 17 6.65971 17 8v9.5l.6667.5H6.33333L7 17.5V8c0-1.34029.55463-2.26536 1.39959-2.90914.9-.68571 2.19941-1.09035 3.59781-1.09086z"/></svg>';
export const nrkCloseNoViewBox = '<svg id="NrkCloseNoViewBox" viewBox="0 0 15 15" class="nrk-close-no-viewBox" width="15.000em" height="15.000em"  aria-hidden="true" focusable="false"><path stroke="currentColor" stroke-linecap="round" d="M2 2l11 11M2 13L13 2"/></svg>';
export const nrkClose = '<svg id="NrkClose" viewBox="0 0 24 24" class="nrk-close" width="24.000em" height="24.000em"  aria-hidden="true" focusable="false"><path fill="currentColor" fill-rule="evenodd" clip-rule="evenodd" d="M12 10.5858l6.2929-6.29289 1.4142 1.41421L13.4142 12l6.2929 6.2929-1.4142 1.4142L12 13.4142l-6.29288 6.2929-1.41421-1.4142L10.5858 12 4.29291 5.70712l1.41421-1.41421L12 10.5858z"/></svg>';
export const nrkDownload = '<svg id="NrkDownload" viewBox="0 0 24 24" class="nrk-download" width="24.000em" height="24.000em" fill="currentColor" aria-hidden="true" focusable="false"><path d="M13 2h-2v15.1l-7-4.4V15l8 5 8-5v-2.3l-7 4.4V2Z"/><path d="M4 22h16v2H4z" opacity=".5"/></svg>';