npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

@odczynflnpm/harum-quaerat-atque

v1.0.0

Published

[![NPM][npm-image]][npm-url]

Maintainers

ducvinh101011zducvinh101011z

Keywords

functionscreateInt16ArrayshellglobdropObjectstarterbusycallbackflathttppackage.jsonschemadotenvpropertiesbyteprivate dataqueueMicrotaskstylei18ncss-in-jsbundlingformfluxreplaylrutypesafeobjectvalidatepathreactArray.prototype.includesfiletscore-jsprefixUint16Arrayes2015callboundECMAScript 2021negative zerowatchermimetypestyped arraytoolscoreObservablestypeES2023parentsextendbufferArray.prototype.flattenwatchfastcloneastloadinglibphonenumberdir256readablestreamarrayiamdeletevariables in csssqsStreamsRxprototypetouchsharedarraybuffereslint-pluginrm -rfpackageslinkjsxstringsymbolcopyemriterationparsinglockfileworkflowbddbufferscss nestingcompile lessFunction.prototype.namequeryfixed-widthdescriptorsserializationsettingsshebangnativeES2018deepcopyassertiongradients cssenderlinewrapidleexecvpcapiflatMapfromconcurrencysafeless cssopenquotePromiseoffsetutil.inspectrgbgetfastcopyeveryendpointwrapdefinePropertyhoteslintconfigrmscheme-validationString.prototype.matchAlljapanesepromisefigletconsolefinditeratesymbolsischineseregular expressionsES2017fetchrm -frmetadatadatastructurecontainsObservableInt8ArraypatchjwtES7taskenumerable0lesscsscheckreadablevariablesaccessibilityponyfillpasswordObject.getPrototypeOfhas-ownboundObject.keysremoveglacierincludeselectrones-shimsmatchmruwordbreaktrimEndtraverseparsetddtoArraychromeCSSStyleDeclarationargvchromiumredirectWebSocketsspeedsesES2019utilitypolyfillvaluees8optiontestingtestecmascriptmochaargparsebrowserslistES8comparefullwidthlookwalkingsettermime-dbMicrosoftbrowserpromisesES2015s3internalshimshrinkwrapxtermmixinsECMAScript 2023colourInt32ArrayECMAScript 2015csskarmastdlibtypeerrorratemimeformatfast-copyinternal slotArray.prototype.findLastcomputed-typestostringtagstreamsbcrypthooks.envredux-toolkitloadbalancingtrimjQuerypreprocessorelmonceartwhichsideBigUint64ArraycircularsymlinkeventDispatcherform-validationcolumneventEmitterObject.fromEntriesvaluesestreeperformanceWebSocketdiffvalidationcompilerUint8ArraycolorsutilitiesFloat32Arrayfunctionimmerentriesobjnumberpropertyfastless.jsrangeerrorenvmkdirsmkdirpflattenargsreact-hook-formrequirelimitthrottlehardlinksUnderscorewalkstylestrimStartdebuggerdefineYAMLJSON-Schemaa11ytypedarraysassertsortedflagTypeBoxcolorgroupByuuidextensiontoSortedtypeofSymboltypesmobileTypedArrayES2021progressbluebirdes2016columnstoStringTagfindupgdprjsterminal$.extendwidthwordwrapxhrlazylengthtc39cloudsearchtapeavainconfiginstallernopezeroes5hasdeep-clonewarningdeterministicRegExp.prototype.flagspersistentStyleSheetECMAScript 6emitsyntaxerrorcoercibleRFC-6455JSONcss variableflagsdeepclonebeanstalkdateconfigurableHyBiec2equalitySetduplexes6bindapollobyteLengthsetImmediatestylesheetassertscloudfrontsetwebasciikinesishasOwnPropertyenvironmentloggingqsvalidURLSearchParamspropmergeUint8ClampedArrayruntimeiteratorreact-hooksdataViewlanguagelook-upArrayBuffernegativechannelargumentbootstrap lessprivateReflect.getPrototypeOfrapidparserwatchFileSymbol.toStringTaglocationio-tsES3classnamedataexpressionmodulessharedprotocol-buffersmakeFloat64ArrayttyArray.prototype.containsintrinsicpnpm9class-validatorslicestylingstreamfull-widthstoragegatewaygetPrototypeOfrandomeventsbannersameValueZeroesgetintrinsicupfindLast__proto__picomatchtypanionshamconcatMapArray.prototype.flatMapsequenceuninstallrdsdom-testing-librarytslibelbkoreanequaldeep-copyhasOwngradients css3WeakSetnested csscensorlimitedloggerbyteOffset@@toStringTagcloudwatchawesomesauceregexpESnextPushbreakmapreducepipe-0forEachmomentlesscss lesses7zodArrayieES6classesmkdirstructuredClonecollection.es6syntaxhookformcorsgetterarktypeencryptionextrajsdompretty[[Prototype]]find-upbootstrap cssnamesmapimportreact-testing-librarydescriptorwaityupsorthigher-orderdataviewfile systemdommoduleawaitArrayBuffer.prototype.sliceconcatcommanderwritetypedarraysuperagentes2018

Readme

preprocess

NPM

Linux Build Status Windows Build Status Coverage Status dependencies dev-dependencies

Preprocess HTML, JavaScript, and other files with directives based off custom or ENV configuration

Configuration

Install via npm:

$ npm install --save preprocess

What does it look like?

<head>
  <title>Your App</title>

  <!-- @if NODE_ENV='production' -->
  <script src="some/production/lib/like/analytics.js"></script>
  <!-- @endif -->

</head>
<body>
  <!-- @ifdef DEBUG -->
  <h1>Debugging mode - <!-- @echo RELEASE_TAG --> </h1>
  <!-- @endif -->
  <p>
  <!-- @include welcome_message.txt -->
  </p>
</body>
var configValue = '/* @echo FOO */' || 'default value';

// @ifdef DEBUG
someDebuggingCall()
// @endif

Directive syntax

Basic example

The most basic usage is for files that only have two states, non-processed and processed. In this case, your @exclude directives are removed after preprocessing

<body>
    <!-- @exclude -->
    <header>You're on dev!</header>
    <!-- @endexclude -->
</body>

After build

<body>
</body>

All directives

  • @if VAR='value' / @endif This will include the enclosed block if your test passes
  • @ifdef VAR / @endif This will include the enclosed block if VAR is defined (typeof !== 'undefined')
  • @ifndef VAR / @endif This will include the enclosed block if VAR is not defined (typeof === 'undefined')
  • @include This will include the source from an external file. If the included source ends with a newline then the following line will be space indented to the level the @include was found.
  • @include-static Works the same way as @include but doesn't process the included file recursively. Is useful if a large file has to be included and the recursive processing is not necessary or would otherwise take too long.
  • @extend file.html / @endextend This will use the source from the external file indicated with the @extend tag to wrap the enclosed block.
  • @extendable This tag is used to indicate the location in a file referenced using @extend where the block enclosed by @extend will be populated.
  • @exclude / @endexclude This will remove the enclosed block upon processing
  • @echo VAR This will include the environment variable VAR into your source
  • @foreach $VAR in ARR / @endfor This will repeat the enclosed block for each value in the Array or Object in ARR. Each value in ARR can be interpolated into the resulting content with $VAR.
  • @exec FUNCTION([param1, param2...]) This will execute the environment FUNCTION with its parameters and echo the result into your source. The parameter could be a string or a reference to another environment variable.

Extended html Syntax

This is useful for more fine grained control of your files over multiple environment configurations. You have access to simple tests of any variable within the context (or ENV, if not supplied)

<body>
    <!-- @if NODE_ENV!='production' -->
    <header>You're on dev!</header>
    <!-- @endif -->

    <!-- @if NODE_ENV='production' -->
    <script src="some/production/javascript.js"></script>
    <!-- @endif -->

    <script>
    var fingerprint = '<!-- @echo COMMIT_HASH -->' || 'DEFAULT';
    </script>

    <script src="<!-- @exec static_path('another/production/javascript.js') -->"></script>
</body>

With a NODE_ENV set to production and 0xDEADBEEF in COMMIT_HASH this will be built to look like

<body>
    <script src="some/production/javascript.js"></script>

    <script>
    var fingerprint = '0xDEADBEEF' || 'DEFAULT';
    </script>

    <script src="http://cdn2.my.domain.com/another/javascript.js"></script>
</body>

With NODE_ENV not set or set to dev and nothing in COMMIT_HASH, the built file will be

<body>
    <header>You're on dev!</header>

    <script>
    var fingerprint = '' || 'DEFAULT';
    </script>

    <script src="http://localhost/myapp/statics/another/javascript.js"></script>
</body>

You can also have conditional blocks that are hidden by default by using the fictional !> end tag instead of --> after your condition:

<!-- @if true !>
<p>Process was run!</p>
<!-- @endif -->

JavaScript, CSS, C, Java Syntax

Extended syntax below, but will work without specifying a test

normalFunction();
//@exclude
superExpensiveDebugFunction()
//@endexclude

anotherFunction('/* @echo USERNAME */');

Built with a NODE_ENV of production :

normalFunction();

anotherFunction('jsoverson');

Like HTML, you can have conditional blocks that are hidden by default by ending the directive with a ** instead of */

angular.module('myModule', ['dep1'
    , 'dep2'
    /* @if NODE_ENV='production' **
    , 'prod_dep'
    /* @endif */
    /* @exclude **
    , 'debug_dep'
    /* @endexclude */
]);

Note: Hidden by default blocks only work with block comments (/* */) but not with line comments (//).

CSS example

body {
/* @if NODE_ENV=='development' */
  background-color: red;
/* @endif */

}
// @include util.css

(CSS preprocessing supports single line comment style directives)

Shell, PHP

#!/bin/bash

# @include util.sh

API

preprocess(source[, context[, options]]) -> preprocessedSource

Preprocesses a source provided as a string and returns the preprocessed source.

source

Type: String (mandatory)

The source to preprocess.

context

Type: Object Default: process.env

The context that contains the variables that are used in the source. For @extend variants and @include the additional context property src is available inside of files to be included that contains the current file name. This property is also available in the context of the source file if one of the preprocessFile*() API variants are used.

options

Type: Object

The options object allows to pass additional options to preprocess. Available options are:

options.fileNotFoundSilentFail

Type: Boolean Default: false

When using @include variants and @extend, preprocess will by default throw an exception in case an included file can't be found. Set this option to true to instruct preprocess to fail silently and instead of throwing to write a message inside of the preprocessed file that an included file could not be found.

options.srcDir

Type: String Default: process.cwd()

The directory where to look for files included via @include variants and @extend.

options.srcEol

Type: String Default: EOL of source string or os.EOL if source string contains multiple different or no EOLs.

The end of line (EOL) character to use for the preprocessed result. May be one of:

  • \r\n - Windows
  • \n - Linux/OSX/Unix
  • \r - legacy Mac
options.type

Type: String Default: html

The syntax type of source string to preprocess. There are 3 main syntax variants:

  • html, aliases: xml
  • js, aliases: javascript, jsx, json, c, cc, cpp, cs, csharp, java, less, sass, scss, css, php, ts, tsx, peg, pegjs, jade, styl
  • coffee, aliases: bash, shell, sh

preprocessFile(srcFile, destFile[, context[, callback[, options]]])

Preprocesses a sourceFile and saves the result to destFile. Simple wrapper around fs.readFile() and fs.writeFile().

srcFile

Type: String (mandatory)

The path to the source file to preprocess.

destFile

Type: String (mandatory)

The path to the destination file where the preprocessed result shall be saved.

context

See context attribute description of preprocess() function.

callback

Type: function(err)

The callback function that is called upon error or completion. Receives an error if something goes wrong as first parameter.

options

See options attribute description of preprocess() function. Differs only in that the default srcDir value is set to the path of the provided source file instead of process.cwd() and the default type is derived from source file extension.

preprocessFileSync(srcFile, destFile[, context[, options]])

Preprocesses a sourceFile and saves the result to destFile. Simple wrapper around fs.readFileSync() and fs.writeFileSync().

srcFile

Type: String (mandatory)

The path to the source file to preprocess.

destFile

Type: String (mandatory)

The path to the destination file where the preprocessed result shall be saved.

context

See context attribute description of preprocess() function.

options

See options attribute description of preprocess() function. Differs only in that the default srcDir value is set to the path of the provided source file instead of process.cwd() and the default type is derived from source file extension.

Usage Examples

var pp = require('preprocess');

var text = 'Hi, I am <!-- @echo USERNAME -->';

pp.preprocess(text);
// -> Hi, I am jsoverson

pp.preprocess(text, {USERNAME : "Bob"});
// -> Hi, I am Bob

// specify the format to use for the directives as the third parameter
pp.preprocess(text, {USERNAME : "Bob"}, {type: 'html'});
// -> Hi, I am Bob

// Preprocess files asynchronously
pp.preprocessFile(src, dest, context, callback, options);

// Preprocess files synchronously
pp.preprocessFileSync(src, dest, context, options);

Contributing

In lieu of a formal styleguide, take care to maintain the existing coding style. Add unit tests for any new or changed functionality. Lint and test your code using jshint

Release History

  • 3.2.0

    • Fix npm incompatibility on CI (@pioug)
    • Run CI with LTS and latest Node versions (@pioug)
    • Support if-else statement (@hu9o, #121)
    • Add JSON extension as alias for js (@jirikrepl, #111)
  • 3.1.0

    • Added .jsx file extension as an alias for js (@BendingBender, #79)
    • Added .tsx file extension as an alias for js (@rosendi, #100)
    • Bumped XRegExp to v3
  • 3.0.1/2 Fixes for backward compatibility and regex cleanups (thanks to @anseki for suggestions, #77)

  • 3.0.0

    Breaking changes:

    • If a file requested by @include or @extend can not be found, preprocess will now throw by default with a possibility to opt in to the legacy behavior via the fileNotFoundSilentFail option (@BendingBender, #35).
    • Fixed multiple issues with newlines (@BendingBender, #8), this may result in output that differs from earlier versions.
    • The srcDir option was moved to the options object and now defaults to process.cwd instead of throwing by default (@BendingBender, #68)

    New functionality:

    • All block directives (ones that have a start and an end token, like @if/@endif) are now processed recursively (@Frizi, #61)
    • Added hidden by default configuration blocks for js (@mallowigi, #40) and html (@Frizi, #66)

    Fixes:

    • fixed @exec in files included via @include and @extend (@BendingBender, #58)
    • changed @extend and @exclude html regex so that directives may appear more than once in one line (@BendingBender, #36)
    • fixed multiple issues with coffescript syntax (@BendingBender, #39)
    • fixed @if and @foreach to not require trailing whitespace (@BendingBender, #74)
  • 2.3.1 Fixed @echo and @exec directives to allow - and * characters, fixed @exec with multiple params (@BendingBender, #21, #45, #51, #54).

  • 2.3.0 Added support for @include-static (@BendingBender)

  • 2.2.0 Added support for @foreach and @extend (@orionstein)

  • 2.1.1 Added support for .styl files via js regex (@nsonnad)

  • 2.1.0 Added automatic support for numerous formats, merged @exec, hidden by default html tags, added simple directives

  • 2.0.0 Added ability to echo strings, added conditional comments, removed lodash, merged 17, 13, 15, 16

  • 1.2.0 Added processing for hash-style comments (@marsch). Added more file aliases.

  • 1.1.0 Added deep inclusion, fixed sequential ifs

  • 1.0.1 Fixed multiple inline echo statements

  • 1.0.0 Pulled from grunt-preprocess to stand alone

License

Copyright Jarrod Overson

Written by Jarrod Overson

Licensed under the Apache 2.0 license.