npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

@redocly/redoc

v0.137.1

Published

Vulnerabilities

Powered byPowered by Snyk
  • 0High
  • 0Medium
  • 0Low

Links

Maintainers

romanhotsiyromanhotsiyalawaralawaradamaltmanadamaltmanmarshevskyymarshevskyyvolodymyr-rutskyivolodymyr-rutskyi

Keywords

Readme

Redoc

Redoc is Redocly's tool for generating API documentation from API description files.

Features

  • API documentation - transform API description files into responsive, human-readable API documentation with automatically generated code samples
  • Supported specifications:
    • OpenAPI (formerly Swagger)
    • GraphQL
    • AsyncAPI
    • SOAP
  • Mock servers - test your OpenAPI documentation with automatically created mock server at your custom domain
  • Linting - use built-in rules or create custom rules to govern your APIs
  • Redocly Integration - works seamlessly with Revel branding, multi-product support, and localization and with Reef for internal catalogs

Live demo

For a demo of Redoc, see our Museum API.

Installation

Install Redoc using npm:

npm install @redocly/redoc

Or using pnpm:

pnpm add @redocly/redoc

Or using yarn:

yarn add @redocly/redoc

Usage

Redoc is designed to work seamlessly as part of the Redocly ecosystem. It integrates with:

  • Revel - for localization, branding, and multi-product support
  • Reef - for internal service catalogs
  • Realm - the complete combination of Redoc, Revel, and Reef
  • Reunite - for docs-as-code workflows and collaboration

Support

Built with 💙 by Redocly