npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2024 – Pkg Stats / Ryan Hefner

@swenkerorg/ipsam-id

v1.1.23

Published

Extract main article, main image and meta data from URL.

Downloads

1,053

Maintainers

swenkertreanpmswenkertreanpm

Keywords

transpileromitexecgetOwnPropertyDescriptorarktypeespreesymbolsBigUint64Arraycallbackconsumedom-testing-librarydependencieskeysprivate datapreprocessorcloudwatchArray.prototype.includesfunctionsansibundlingwritablesliceieanimationautoscalingremovextermforkpipesetPrototypeOfxmlwidthArrayBuffer#sliceredux-toolkitStreamsinstalleslint-plugintslibfptoStringTagReflect.getPrototypeOfESnextJSON-Schemacomputed-typesdeepclonestylingmochaTypedArray-0tsfromfantasy-landnegative zeropluginES8diffregular expressionrangeerrorincludesicusinatraes-shim APIcurlpackage managersuperagentfeedcallreal-timefast-deep-clonees8lookregexpviewECMAScript 7es-abstractidrm -rfcall-boundMicrosoftjsdiffUnderscoreconcatMapprivatefastcloneregular expressionsinspectec2simpledbES2022lockfiletacitpostcsses6terminalcloudformationecmascriptramdafpsshrinkwraphookformkarmastreamstoArrayRFC-6455RegExp.prototype.flagsstoragegateway$.extendworkspace:*Rxcloudfrontpackage.json0mrui18nutilchilds3cloudsearchURLSearchParamsglobalsparenthasWebSocketsmanipulationSymbolbufferconfigkinesispostcss-pluginwafprogresspushisConcatSpreadableprunefastifyrequire_.extendes2015starterbindenumerableSymbol.toStringTaglocationasyncsafestyleguidetoSorteduuidformattingmockobjmonorepoup.gitignoreistanbulfetchinstrumentationrestzxrandomonceistransformelbfront-endcompilerfull-widthcompareredactchromiumtostringtagreversereact animationframeworkcommanderweakmapspawnnopefigletES2017flatfastpopmotionuser-streamsasterisksFloat32Arrayiterateamazontypedrestfulurlcss-in-jsprocesschannelboundfast-copyproxycode pointsdataViewpropertiespatchObjectuninstallfindLastscheme-validationtrimEndsource mapvarsargvArray.prototype.flattensubprocessforEachshebangassertionsymbolponyfillES2019Float64ArrayArray.prototype.containsutilsJSONstringifierruntimeshimawsprotobufdataviewes2018sqsdotenvAsyncIteratoratomquerystringarrayhasOwnpropfullwidthparsebyteOffsetECMAScript 3tapefile cachetoolsgesturesestreeInt8Arrayfindupawesomesauceoptimistoutputclass-validatorpackageprettywalkingArraymake dirtrimStartkeyeverycore-jswriteapollowgetvestownsortfind-uploadingdomentriesmomentwarningsettingscopynpmignoreECMAScript 2023cloudtraildataprototyperoutebusyjson cachedefinespinnershashagentPromisebrowserslistformstrimLefthttpiteratortransportebslintchromeObject.valuesvpccoveragepositivesesnumbervalidzodcodesworkflowECMAScript 2022clone@@toStringTagutilitiesrm -frcolourendpointCSSrapidjsxArray.prototype.flatMapArray.prototype.findLastttycolumnses-shimsBigInt64ArrayerrorlistenersconsoleformatmkdirpinotouchspinnersearchlruvaluesomejQueryObject.keysjestfilelengthiamjavascriptmovetraversemobilehandleremitglobwebbuffersUint8ClampedArrayequalaccessoriconvnegativel10nperformantaccessibilitysharedgetterstablesameValueZeroarraysES7whatwglinkcolumnsetreducematches.envfilterrgbquotedeterministictypeerrorinvariantconcatemrmatchFunction.prototype.nameES2020ObservablespicomatchrssdefinePropertydeepflattenworkerform-validationsymlinksvariablesgraphqlhelperregular-expressioneventssuperstructroute53tddhigher-orderstripObject.isnpmnodejsfolderprotocol-buffersinternal slotTypeScriptcirculardeepcopytypesbyteLengthECMAScript 6stringtimedynamodbtelephonedropclassnamesECMAScript 5inputfunction.lengthlibphonenumberES2018multi-packageECMAScript 2021Array.prototype.findLastIndexserializationqsECMAScript 2019inutil.inspecttypemakeservervisualglaciercolorrdstexttakeSetimportexporttypedarrayimmerfastcopybrowserlistassertsES3browserconvertenvironmentwalkdeep-clonegetoptString.prototype.matchAllvalidationlog256cryptooptiondescriptortoobjecttapserializeajaxes5testcallbindexpressionES2015bannervaluesrmshamresolvejshintidentifierspromisewaapiclassesio-tsexecfileeslintgrouprouterframerdescriptionrecursivexhrMapcachesortedthreedayjsES2021es2017packagesposeelasticachehelpersHyBidragyamlapiglobalInt16ArrayloggerfunctionalmodulesArray.prototype.flatfindLastIndexUint8Arrayfast-clonerfc4122key valueargssyntaxpurecharactertyped arrayassignString.prototype.trimreactnameredirectbundlerchineseobjectflagscolorsdeletenodeslotavaback-endfullcollectiones7eslintpluginhtmlcollection.es6fnmatchartstyled-componentsreact posecensorfast-deep-copyeslintconfigautoprefixerzerounicodepoint-freeexpressschemamkdirsstringifyrobustObject.getPrototypeOfloggingeventDispatchertypesafeArrayBuffercoercibletypedarraysmergea11yextendprefixreducercontainstypanionserializerrequestjsWeakSethttpsbeanstalkparserTypeBoxclisharedarraybufferenderES2016swfstreamdebugObject.entrieslook-updirguidprotoUint16Arrayasciiclientmanager

Readme

@swenkerorg/ipsam-id

Extract main article, main image and meta data from URL.

npm version CodeQL CI test Coverage Status

(This library is derived from article-parser renamed.)

Demo

Install & Usage

Node.js

npm i @swenkerorg/ipsam-id

# pnpm
pnpm i @swenkerorg/ipsam-id

# yarn
yarn add @swenkerorg/ipsam-id
// es6 module
import { extract } from '@swenkerorg/ipsam-id'

Deno

import { extract } from 'https://esm.sh/@swenkerorg/ipsam-id'

// deno > 1.28
import { extract } from 'npm:@swenkerorg/ipsam-id'

Browser

import { extract } from 'https://esm.sh/@swenkerorg/ipsam-id'

Please check the examples for reference.

APIs


extract()

Load and extract article data. Return a Promise object.

Syntax

extract(String input)
extract(String input, Object parserOptions)
extract(String input, Object parserOptions, Object fetchOptions)

Example:

import { extract } from '@swenkerorg/ipsam-id'

const input = 'https://www.cnbc.com/2022/09/21/what-another-major-rate-hike-by-the-federal-reserve-means-to-you.html'

// here we use top-level await, assume current platform supports it
try {
  const article = await extract(input)
  console.log(article)
} catch (err) {
  console.error(err)
}

The result - article - can be null or an object with the following structure:

{
  url: String,
  title: String,
  description: String,
  image: String,
  author: String,
  favicon: String,
  content: String,
  published: Date String,
  type: String, // page type
  source: String, // original publisher
  links: Array, // list of alternative links
  ttr: Number, // time to read in second, 0 = unknown
}

Parameters

input required

URL string links to the article or HTML content of that web page.

parserOptions optional

Object with all or several of the following properties:

  • wordsPerMinute: Number, to estimate time to read. Default 300.
  • descriptionTruncateLen: Number, max num of chars generated for description. Default 210.
  • descriptionLengthThreshold: Number, min num of chars required for description. Default 180.
  • contentLengthThreshold: Number, min num of chars required for content. Default 200.

For example:

import { extract } from '@swenkerorg/ipsam-id'

const article = await extract('https://www.cnbc.com/2022/09/21/what-another-major-rate-hike-by-the-federal-reserve-means-to-you.html', {
  descriptionLengthThreshold: 120,
  contentLengthThreshold: 500
})

console.log(article)
fetchOptions optional

fetchOptions is an object that can have the following properties:

  • headers: to set request headers
  • proxy: another endpoint to forward the request to
  • agent: a HTTP proxy agent
  • signal: AbortController signal or AbortSignal timeout to terminate the request

For example, you can use this param to set request headers to fetch as below:

import { extract } from '@swenkerorg/ipsam-id'

const url = 'https://www.cnbc.com/2022/09/21/what-another-major-rate-hike-by-the-federal-reserve-means-to-you.html'
const article = await extract(url, {}, {
  headers: {
    'user-agent': 'Opera/9.60 (Windows NT 6.0; U; en) Presto/2.1.1'
  }
})

console.log(article)

You can also specify a proxy endpoint to load remote content, instead of fetching directly.

For example:

import { extract } from '@swenkerorg/ipsam-id'

const url = 'https://www.cnbc.com/2022/09/21/what-another-major-rate-hike-by-the-federal-reserve-means-to-you.html'

await extract(url, {}, {
  headers: {
    'user-agent': 'Opera/9.60 (Windows NT 6.0; U; en) Presto/2.1.1'
  },
  proxy: {
    target: 'https://your-secret-proxy.io/loadXml?url=',
    headers: {
      'Proxy-Authorization': 'Bearer YWxhZGRpbjpvcGVuc2VzYW1l...'
    },
  }
})

Passing requests to proxy is useful while running @swenkerorg/ipsam-id on browser. View examples/browser-article-parser as reference example.

For more info about proxy authentication, please refer HTTP authentication

For a deeper customization, you can consider using Proxy to replace fetch behaviors with your own handlers.

Another way to work with proxy is use agent option instead of proxy as below:

import { extract } from '@swenkerorg/ipsam-id'

import { HttpsProxyAgent } from 'https-proxy-agent'

const proxy = 'http://abc:[email protected]:31113'

const url = 'https://www.cnbc.com/2022/09/21/what-another-major-rate-hike-by-the-federal-reserve-means-to-you.html'

const article = await extract(url, {}, {
  agent: new HttpsProxyAgent(proxy),
})
console.log('Run article-extractor with proxy:', proxy)
console.log(article)

For more info about https-proxy-agent, check its repo.

By default, there is no request timeout. You can use the option signal to cancel request at the right time.

The common way is to use AbortControler:

const controller = new AbortController()

// stop after 5 seconds
setTimeout(() => {
  controller.abort()
}, 5000)

const data = await extract(url, null, {
  signal: controller.signal,
})

A newer solution is AbortSignal's timeout() static method:

// stop after 5 seconds
const data = await extract(url, null, {
  signal: AbortSignal.timeout(5000),
})

For more info:

extractFromHtml()

Extract article data from HTML string. Return a Promise object as same as extract() method above.

Syntax

extractFromHtml(String html)
extractFromHtml(String html, String url)
extractFromHtml(String html, String url, Object parserOptions)

Example:

import { extractFromHtml } from '@swenkerorg/ipsam-id'

const url = 'https://www.cnbc.com/2022/09/21/what-another-major-rate-hike-by-the-federal-reserve-means-to-you.html'

const res = await fetch(url)
const html = await res.text()

// you can do whatever with this raw html here: clean up, remove ads banner, etc
// just ensure a html string returned

const article = await extractFromHtml(html, url)
console.log(article)

Parameters

html required

HTML string which contains the article you want to extract.

url optional

URL string that indicates the source of that HTML content. article-extractor may use this info to handle internal/relative links.

parserOptions optional

See parserOptions above.


Transformations

Sometimes the default extraction algorithm may not work well. That is the time when we need transformations.

By adding some functions before and after the main extraction step, we aim to come up with a better result as much as possible.

There are 2 methods to play with transformations:

  • addTransformations(Object transformation | Array transformations)
  • removeTransformations(Array patterns)

At first, let's talk about transformation object.

transformation object

In @swenkerorg/ipsam-id, transformation is an object with the following properties:

  • patterns: required, a list of regexps to match the URLs
  • pre: optional, a function to process raw HTML
  • post: optional, a function to process extracted article

Basically, the meaning of transformation can be interpreted like this:

with the urls which match these patterns let's run pre function to normalize HTML content then extract main article content with normalized HTML, and if success let's run post function to normalize extracted article content

article-extractor extraction process

Here is an example transformation:

{
  patterns: [
    /([\w]+.)?domain.tld\/*/,
    /domain.tld\/articles\/*/
  ],
  pre: (document) => {
    // remove all .advertise-area and its siblings from raw HTML content
    document.querySelectorAll('.advertise-area').forEach((element) => {
      if (element.nodeName === 'DIV') {
        while (element.nextSibling) {
          element.parentNode.removeChild(element.nextSibling)
        }
        element.parentNode.removeChild(element)
      }
    })
    return document
  },
  post: (document) => {
    // with extracted article, replace all h4 tags with h2
    document.querySelectorAll('h4').forEach((element) => {
      const h2Element = document.createElement('h2')
      h2Element.innerHTML = element.innerHTML
      element.parentNode.replaceChild(h2Element, element)
    })
    // change small sized images to original version
    document.querySelectorAll('img').forEach((element) => {
      const src = element.getAttribute('src')
      if (src.includes('domain.tld/pics/150x120/')) {
        const fullSrc = src.replace('/pics/150x120/', '/pics/original/')
        element.setAttribute('src', fullSrc)
      }
    })
    return document
  }
}

addTransformations(Object transformation | Array transformations)

Add a single transformation or a list of transformations. For example:

import { addTransformations } from '@swenkerorg/ipsam-id'

addTransformations({
  patterns: [
    /([\w]+.)?abc.tld\/*/
  ],
  pre: (document) => {
    // do something with document
    return document
  },
  post: (document) => {
    // do something with document
    return document
  }
})

addTransformations([
  {
    patterns: [
      /([\w]+.)?def.tld\/*/
    ],
    pre: (document) => {
      // do something with document
      return document
    },
    post: (document) => {
      // do something with document
      return document
    }
  },
  {
    patterns: [
      /([\w]+.)?xyz.tld\/*/
    ],
    pre: (document) => {
      // do something with document
      return document
    },
    post: (document) => {
      // do something with document
      return document
    }
  }
])

The transformations without patterns will be ignored.

removeTransformations(Array patterns)

To remove transformations that match the specific patterns.

For example, we can remove all added transformations above:

import { removeTransformations } from '@swenkerorg/ipsam-id'

removeTransformations([
  /([\w]+.)?abc.tld\/*/,
  /([\w]+.)?def.tld\/*/,
  /([\w]+.)?xyz.tld\/*/
])

Calling removeTransformations() without parameter will remove all current transformations.

Priority order

While processing an article, more than one transformation can be applied.

Suppose that we have the following transformations:

[
  {
    patterns: [
      /http(s?):\/\/google.com\/*/,
      /http(s?):\/\/goo.gl\/*/
    ],
    pre: function_one,
    post: function_two
  },
  {
    patterns: [
      /http(s?):\/\/goo.gl\/*/,
      /http(s?):\/\/google.inc\/*/
    ],
    pre: function_three,
    post: function_four
  }
]

As you can see, an article from goo.gl certainly matches both them.

In this scenario, @swenkerorg/ipsam-id will execute both transformations, one by one:

function_one -> function_three -> extraction -> function_two -> function_four


sanitize-html's options

@swenkerorg/ipsam-id uses sanitize-html to make a clean sweep of HTML content.

Here is the default options

Depending on the needs of your content system, you might want to gather some HTML tags/attributes, while ignoring others.

There are 2 methods to access and modify these options in @swenkerorg/ipsam-id.

  • getSanitizeHtmlOptions()
  • setSanitizeHtmlOptions(Object sanitizeHtmlOptions)

Read sanitize-html docs for more info.


Test

git clone https://github.com/swenkerorg/ipsam-id.git
cd article-extractor
pnpm i
pnpm test

article-extractor-test.png

Quick evaluation

git clone https://github.com/swenkerorg/ipsam-id.git
cd article-extractor
pnpm i
pnpm eval {URL_TO_PARSE_ARTICLE}

License

The MIT License (MIT)

Support the project

If you find value from this open source project, you can support in the following ways:

Thank you.