npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

dlwr-feature-viewer-typescript

v2.3.17

Published

This is a code repository for the BioComputingUP Feature Viewer project. Full documentation at: https://biocomputingup.github.io/FeatureViewerTypeScript-documentation/.

Readme

TypeScript Feature Viewer

This is a code repository for the BioComputingUP Feature Viewer project. Full documentation at: https://biocomputingup.github.io/FeatureViewerTypeScript-documentation/.

The Feature-Viewer was published as:

| The Feature-Viewer: a visualization tool for positional annotations on a sequence | | ------------- | | L. Paladin, M. Schaeffer et al., Bioinformatics 2020 |

This project is based on the Javascript version calipho-sib/feature-viewer, Copyright (c) 2015, SIB Swiss Institute of Bioinformatics. This version is based on Typescript and compatible with Angular 2+ framework.

Represent biological data with the feature viewer library! Used in MobiDB, DisProt, RepeatsDB and PhytotypeDB.

Dependencies

Getting started

1 Install the library using npm

npm install feature-viewer-typescript

2 Import the feature viewer in javascript or your angular component

import {FeatureViewer} from 'feature-viewer-typescript/lib';

3 Optional: if you are installing the feature viewer in an Angular 2+ based App, you may need to load the feature viewer stylesheet in your angular.json "styles" to ensure the correct pioritization of stylesheets.

styles: [
    "./node_modules/feature-viewer-typescript/assets/fv.scss"
]

4 Place the feature viewer in your html

<div id="myfv"></div>

5 Create an instance of the feature viewer in javascript and style it

const proteinsequence = 'MTKFTILLISLLFCIAHTCSASKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEE'
const fv = new FeatureViewer(proteinsequence, '#myfv', {
               showAxis: true,
               showSequence: true,
               toolbar: true,
               toolbarPosition: 'left',
               zoomMax: 10,
               flagColor: '#DFD5F5'
           });

6 Add features and subfeatures

fv.addFeatures(
      [
        { // simple rect
          type: 'rect',
          id: 'useUniqueId',
          data: [ {
            x: 50, y: 78,
            tooltip: '<button class="myButton">Button</button>'} ],
        },
        { // circles
          type: 'circle',
          id: 'mycircle',
          label: 'Circle feature',
          data: [{x: 10 , y: 100}, {x: 50, y: 70}, {x: 40, y: 60, color: '#00ac8f', tooltip: 'I have different color'}],
          color: '#61795e'
        },
        { // curve (height and yLim) with tooltip and subfeatures
          type: 'curve',
          id: 'mycurve',
          label: 'Curve label',
          data: [{x: 1, y: 0}, {x: 40, y: 102}, {x: 80, y: 5}, {x: 50, y: 184}, {x: 75, y: 4}],
          height: 1,
          yLim: 200,
          color: '#00babd',
          tooltip: '<b>Very</b> <span style="color: #C21F39">Stylable</span> <b><i><span style="color: #ffc520">Tooltip </span></i></b>',
          subfeatures: [
            {
              type: 'rect',
              data: [
                {x: 20, y: 30},
                {x: 15, y: 45},
                {x: 70, y: 76, label: 'myRect', tooltip: 'myTooltip'}
              ],
              id: 'aDifferentId',
              label: 'I am a subfeature!'
            }
          ]
        }
      ]
    )

7 Output

Feature Viewer

Support

If you have any problem or suggestion please open an issue.

Developers

Build with: npm run sass && webpack.

To test: run test-index.html.

License

This repo is based on calipho-sib/feature-viewer, Copyright (c) 2015, SIB Swiss Institute of Bioinformatics.

This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version.