npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

fastfold-ai

v0.1.1

Published

FastFold TypeScript SDK and CLI for submitting folding jobs

Readme

Fastfold AI Typescript SDK

JavaScript/TypeScript SDK and CLI for the Fastfold API.

Quick Start

Get started with the Fastfold API and start folding protein sequences in seconds.

The Fastfold platform provides a simple, production-ready API to fold protein sequences, compute structural properties, run complex workflows, and orchestrate agents. Leverage specialized models, agents, and workflows for protein design and multimodal predictions.

1) Create an API key

Before you can use the API, you need to create an API key in the Fastfold cloud dashboard. Once created, use it to authenticate requests. Keep your key secret (do not commit it), and store it in your environment variables.

macOS / Linux:

export FASTFOLD_API_KEY="your_api_key_here"

Windows (PowerShell):

$env:FASTFOLD_API_KEY="your_api_key_here"

The SDK will automatically pick up the API key from the FASTFOLD_API_KEY environment variable. You can also pass it explicitly via new Client({ apiKey }).

2) Install the Fastfold AI SDK (JavaScript/TypeScript)

npm install fastfold-ai

Node.js 18+ is required (uses global fetch).

3) Fold a protein sequence (JavaScript/TypeScript)

Create a file named example.ts and run:

import { Client } from 'fastfold-ai';

const client = new Client(); // reads FASTFOLD_API_KEY from env

const response = await client.fold.create({
  sequence: '[LL-37, 37 aa]',
  model: 'boltz-2',
});

console.log(response.cif_link ?? response.id);

CommonJS users can wrap in an async IIFE:

const { Client } = require('fastfold-ai');

const client = new Client();

(async () => {
  const response = await client.fold.create({
    sequence: '[LL-37, 37 aa]',
    model: 'boltz-2',
  });
  console.log(response.cif_link ?? response.id);
})();

Next steps

  • Explore all endpoints in the API Reference: API Reference
  • Browse available models and capabilities: Models

You’re ready to fold your own sequences and integrate Fastfold into your pipelines. Happy building!


CLI (optional)

You can also submit jobs via the CLI:

npx fastfold fold --sequence "[LL-37, 37 aa]" --model boltz-2

Optional flags:

fastfold fold \
  --sequence "..." \
  --model boltz-2 \
  --name "My Job" \
  --api-key "sk-..." \
  --base-url "https://api.fastfold.ai"

Requirements

  • Node.js 18+

CLI prints the created job ID to stdout on success.