feature-viewer-burkov
v1.1.1
Published
A lightweight, generic and easy-to-use feature-viewer written in javascript with D3
Downloads
63
Maintainers
Readme
neXtProt - The knowledge resource on human proteins
This is a code repository for the SIB - Swiss Institute of Bioinformatics CALIPHO group neXtProt project
See: http://www.nextprot.org/
neXtProt feature viewer
The feature viewer is a super easy javascript library to use in order to draw the different features covering a sequence for a better visualization.

Live demo : https://cdn.rawgit.com/calipho-sib/feature-viewer/v1.0.0/examples/index.html
Getting Started
1. You can get the library in your project using bower or npm
//BOWER//
bower install feature-viewer
//NODE//
npm install feature-viewerOr Include the feature-viewer JS and CSS from rawgit CDN in the header of your html
<link rel="stylesheet" type="text/css" href="https://cdn.rawgit.com/calipho-sib/feature-viewer/v1.0.0/dist/feature-viewer.min.css">
<script src="https://cdn.rawgit.com/calipho-sib/feature-viewer/v1.0.0/dist/feature-viewer.bundle.js"></script>NOTE : If you already got the dependencies (D3, Bootstrap & Jquery) in your project, use the simple minified version instead of the bundle :
<script src="https://cdn.rawgit.com/calipho-sib/feature-viewer/v1.0.0/dist/feature-viewer.min.js"></script>2. Specify a div in your html
<div id="fv1"></div>3. Create an instance of FeatureViewer in javascript with the sequence (or a length), the div in which it will be display and the rendering options of your choice.
//For Node add before : var FeatureViewer = require("feature-viewer");
var ft = new FeatureViewer('MALWMRLLPLLALLALWGPGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLE',
'#fv1',
{
showAxis: true,
showSequence: true,
brushActive: true, //zoom
toolbar:true, //current zoom & mouse position
bubbleHelp:true,
zoomMax:50 //define the maximum range of the zoom
});
//Instead of a sequence, you can also initialize the feature viewer with a length (integer) :
var ft = new FeatureViewer(213,'#fv1');4. Finally, add the features
ft.addFeature({
data: [{x:20,y:32},{x:46,y:100},{x:123,y:167}],
name: "test feature 1",
className: "test1", //can be used for styling
color: "#0F8292",
type: "rect" // ['rect', 'path', 'line']
});5. Et voila!

Functionalities
Zoom into the Feature-viewer by selecting a part of the sequence with your mouse. Zoom out with a right-click.
You can also zoom programmatically with the methodszoom(start,end)andresetZoom()A tooltip appears when the mouse is over a feature, giving its exact positions, and optionally, a description.
beside the positions for each element, you can also give a description & an ID, allowing you to link click event on the feature to the rest of your project.
Options
- Show axis
- Show sequence
- Brush active (zoom)
- Toolbar (current zoom & position)
- Bubble help
- Zoom max
- Features height
- Offset
ClearInstance()
You may sometimes want to reload your feature-viewer with new parameters. To avoid memory leaks, the method clearInstance() will clear each element & listener for you before you delete the feature-viewer instance.
Documentation
Check out this page for a better understanding of how to use the feature viewer and its possibilities :
- https://cdn.rawgit.com/calipho-sib/feature-viewer/v1.0.0/examples/index.html
Use it with NeXtProt API
It is possible to fill the feature viewer with protein features from NeXtProt, the human protein database.
- First, find your protein of interest in NeXtProt and get the neXtProt accession (NX_...). (You can find your protein by entering an accession number of another database, like UniProt or Ensembl)
- Then, check the type of feature in the NeXtProt API that you would like to add to your viewer. For example, "propeptide" or "mature-protein".
- Include the feature viewer bundle with nextprot to your html : feature-viewer.nextprot.js
- Finally, create your feature-viewer like this :
//initalize nextprot Client
var applicationName = 'demo app'; //please provide a name for your application
var clientInfo='calipho group at sib'; //please provide some information about you
var nx = new Nextprot.Client(applicationName, clientInfo);
//var entry = "NX_P01308";
var isoform = "NX_P01308-1";
// feature viewer options
var options = {showAxis: true, showSequence: true,
brushActive: true, toolbar:true,
bubbleHelp: true, zoomMax:20 };
// Create nextprot feature viewer
nxFeatureViewer(nx, isoform, "#div2", options).then(function(ff){
// Add first custom feature
ff.addFeature({
data: [{x:20,y:32},{x:46,y:100},{x:123,y:167}],
name: "test feature 1",
className: "test1",
color: "#0F8292",
type: "rect",
filter: "type1"
});
// Add second feature from nextprot
var styles = [
{name: "Propeptide",className: "pro",color: "#B3B3B3",type: "rect",filter:"Processing"},
{name: "Mature protein",className: "mat",color: "#B3B3C2",type: "rect",filter:"Processing"}
];
ff.addNxFeature(["propeptide","mature-protein"], styles);
Examples
https://search.nextprot.org/entry/NX_P01308/view/proteomics
Support
If you have any problem or suggestion please open an issue here.
Development
git clone https://github.com/calipho-sib/feature-viewer.git
npm install (will install the development dependencies)
bower install (will install the browser dependencies)
...make your changes and modifications...
npm run dist (will create the min & bundle versions in dist/)
npm run build (will create the bundle js & css in build/ for node)
grunt bump (will push and add a new release)
npm publish (will publish in npm)
License
Copyright (c) 2015, SIB Swiss Institute of Bioinformatics
This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version.
