npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

peptide-mw-calculator

v1.0.0

Published

Zero-dependency peptide molecular weight calculator. Calculate MW and molecular formula from amino acid sequences.

Readme

peptide-mw-calculator

Zero-dependency peptide molecular weight calculator. Calculate monoisotopic molecular weight and molecular formula from amino acid sequences.

Install

npm install peptide-mw-calculator

Usage

import { calculateMolecularWeight, calculateMolecularFormula } from 'peptide-mw-calculator';

// Calculate molecular weight
const mw = calculateMolecularWeight('YGGFL');
console.log(mw); // 555.62 (Leu-enkephalin)

// Calculate molecular formula
const formula = calculateMolecularFormula('YGGFL');
console.log(formula); // "C₂₈H₃₇N₅O₇"

Supported Amino Acids

All 20 standard amino acids (1-letter codes: A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, V) plus common non-standard amino acids used in peptide synthesis.

API

calculateMolecularWeight(sequence: string): number

Calculates the monoisotopic molecular weight of a peptide sequence.

  • sequence: Amino acid sequence in 1-letter code (case-insensitive)
  • Returns: Molecular weight in Daltons (Da)
  • Throws: Error if sequence contains invalid characters

calculateMolecularFormula(sequence: string): string

Calculates the molecular formula with Unicode subscripts.

  • sequence: Amino acid sequence in 1-letter code (case-insensitive)
  • Returns: Molecular formula string (e.g., "C₁₈₇H₂₉₁N₄₁O₅₉")

Examples

// Oxytocin (CYS-TYR-ILE-GLN-ASN-CYS-PRO-LEU-GLY-NH2)
calculateMolecularWeight('CYIQNCPLG'); // 1007.19

// Insulin B chain
calculateMolecularWeight('FVNQHLCGSHLVEALYLVCGERGFFYTPKT'); // 3431.94

// Semaglutide (partial sequence)
calculateMolecularWeight('HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR'); // 3211.48

Accuracy

Uses monoisotopic residue masses (not average masses) for mass spectrometry-grade accuracy. Water loss per peptide bond is accounted for.

License

MIT

Part of

Wikipept — Interactive platform for learning peptide biology.

Encyclopeptide — Academic reference for oligopeptide research.