peptoma-mcp

Official MCP (Model Context Protocol) server for PEPTOMA — connect any AI agent to the open DeSci peptide research platform.

What This Does

peptoma-mcp runs a local MCP server that exposes PEPTOMA's full research platform as tools to any compatible AI agent — Claude Desktop, Cursor, VS Code, Zed, and any other MCP-compatible client.

Once connected, your AI agent can:

• Submit peptide sequences for AI analysis and receive bioactivity scores, structure predictions, toxicity risk, and half-life estimates
• Search and filter the open PEPTOMA research feed of thousands of analyzed sequences
• Read and write peer-review annotations to earn $PEPTM token rewards
• Query token balances, staking tiers, and the contributor leaderboard

No custom code required. Install, configure, and your agent is connected to the live PEPTOMA platform.

Requirements

• Node.js ≥ 18
• A PEPTOMA API key (pptm_...) — available to PRO (≥ 2,000 $PEPTM staked) and LAB (≥ 10,000 $PEPTM staked) tier wallets
• Generate your key at peptoma.xyz/missions

Quick Start

# Run directly with npx (no install needed)
npx peptoma-mcp --api-key pptm_your_key_here

# Or install globally
npm install -g peptoma-mcp
peptoma-mcp --api-key pptm_your_key_here

# Or use environment variable
export PEPTOMA_API_KEY=pptm_your_key_here
npx peptoma-mcp

Claude Desktop Setup

Add to ~/.claude/claude_desktop_config.json:

{
  "mcpServers": {
    "peptoma": {
      "command": "npx",
      "args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
    }
  }
}

Restart Claude Desktop. You will now see PEPTOMA tools available in your conversations.

Cursor Setup

Add to your Cursor MCP config (.cursor/mcp.json or global config):

{
  "mcpServers": {
    "peptoma": {
      "command": "npx",
      "args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
    }
  }
}

VS Code (Copilot Agent Mode)

Add to .vscode/mcp.json in your project:

{
  "servers": {
    "peptoma": {
      "type": "stdio",
      "command": "npx",
      "args": ["peptoma-mcp", "--api-key", "pptm_your_key_here"]
    }
  }
}

Available Tools

Once connected, these tools are available to your AI agent:

analyze_sequence

Submit a peptide sequence for analysis by the PEPTOMA AI Engine.

Inputs: | Parameter | Type | Required | Description | |-----------|------|----------|-------------| | sequence | string | Yes | Single-letter amino acid code or FASTA format (3–512 residues) | | depth | "standard" | "deep" | No | Analysis depth (default: "standard") | | diseaseTarget | string | No | Disease or organism context (e.g. "MRSA", "Cancer") | | userId | string | No | Solana wallet address for on-chain attribution | | notes | string | No | Research notes |

Returns: Full SequenceAnalysis object with bioactivity score, label, structure, toxicity, MW, hydrophobicity, charge, half-life, confidence, and annotation suggestions.

get_analysis

Retrieve a previous analysis by ID.

Inputs: id (number)

search_feed

Search the open PEPTOMA research feed.

Inputs: | Parameter | Type | Description | |-----------|------|-------------| | disease | string | Filter by disease target | | minScore | number | Minimum bioactivity score (0–100) | | sort | "newest" | "score" | "annotations" | "trending" | Sort order | | limit | number | Results per page (default: 20) | | page | number | Page number (default: 1) |

get_feed_stats

Platform-wide statistics: total analyses, average scores, annotation counts, disease breakdown.

get_trending

Top 10 sequences ranked by community vote count.

list_annotations

List all peer-review annotations for a sequence.

Inputs: sequenceId (number)

create_annotation

Submit a peer-review annotation and earn $PEPTM.

Inputs: | Parameter | Type | Required | Description | |-----------|------|----------|-------------| | sequenceId | number | Yes | Target sequence ID | | userId | string | Yes | Your wallet address (for token rewards) | | type | "confirm" | "challenge" | "extend" | "tag" | Yes | Annotation type | | content | string | No | Your scientific reasoning or evidence |

Reward rates: confirm +2, challenge +3, extend +5, tag +2 $PEPTM

vote_annotation

Upvote or downvote an annotation.

Inputs: annotationId (number), direction ("up" | "down")

get_token_balance

Get $PEPTM balance and staking info for a user.

Inputs: userId (string — Solana wallet address)

get_leaderboard

Top contributors ranked by total $PEPTM earned.

Example Agent Sessions

Screening antimicrobial candidates:

You: Screen these sequences for MRSA activity and flag anything above 80 with low toxicity:
     KWLRRVWRPQKI, FLPLIGRVLSGIL, GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK

Agent:
  → analyze_sequence("KWLRRVWRPQKI", disease: "MRSA") → score: 91, toxic: low ✓
  → analyze_sequence("FLPLIGRVLSGIL", disease: "MRSA") → score: 67, toxic: medium ✗
  → analyze_sequence("GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK", disease: "MRSA") → score: 88, toxic: low ✓

  2 candidates passed: #1 and #3. Submitting confirmation annotations...
  → create_annotation(sequenceId: 1, type: "confirm", content: "High AMP score, low toxicity...")
  → create_annotation(sequenceId: 3, type: "confirm", content: "Defensin-class AMP candidate...")

Researching what's in the feed:

You: What are the top cancer peptides on PEPTOMA right now?

Agent:
  → search_feed({ disease: "Cancer", sort: "score", limit: 10 })
  Returns ranked list with bioactivity scores, structure types, and annotation counts.

Building a research report:

You: Give me a summary of the PEPTOMA platform activity today

Agent:
  → get_feed_stats() → totalAnalyses: 1,247, recentActivity: 34, avgScore: 71.4
  → get_trending() → top 10 sequences with community vote counts
  → get_leaderboard() → top 5 contributors this period

CLI Options

peptoma-mcp [options]

Options:
  --api-key <key>     Your PEPTOMA API key (pptm_...)
  --base-url <url>    Override API base URL (default: https://peptoma.xyz/api)
  --help              Show help

Environment Variables

| Variable | Description | |----------|-------------| | PEPTOMA_API_KEY | Your PEPTOMA API key — alternative to --api-key flag | | PEPTOMA_BASE_URL | Override API base URL |

Links

| Resource | URL | |----------|-----| | Platform | peptoma.xyz | | Docs | peptoma.xyz/docs | | npm (SDK) | npmjs.com/package/peptoma-sdk | | npm (MCP) | npmjs.com/package/peptoma-mcp | | Token CA | HopMHHPfSV2kWQLghKt6xR1oWbPRLA2UyxnKGoPpump |

License

MIT © 2026 PEPTOMA Team