npm package discovery and stats viewer.

Discover Tips

  • General search

    [free text search, go nuts!]

  • Package details

    pkg:[package-name]

  • User packages

    @[username]

Sponsor

Optimize Toolset

I’ve always been into building performant and accessible sites, but lately I’ve been taking it extremely seriously. So much so that I’ve been building a tool to help me optimize and monitor the sites that I build to make sure that I’m making an attempt to offer the best experience to those who visit them. If you’re into performant, accessible and SEO friendly sites, you might like it too! You can check it out at Optimize Toolset.

About

Hi, 👋, I’m Ryan Hefner  and I built this site for me, and you! The goal of this site was to provide an easy way for me to check the stats on my npm packages, both for prioritizing issues and updates, and to give me a little kick in the pants to keep up on stuff.

As I was building it, I realized that I was actually using the tool to build the tool, and figured I might as well put this out there and hopefully others will find it to be a fast and useful way to search and browse npm packages as I have.

If you’re interested in other things I’m working on, follow me on Twitter or check out the open source projects I’ve been publishing on GitHub.

I am also working on a Twitter bot for this site to tweet the most popular, newest, random packages from npm. Please follow that account now and it will start sending out packages soon–ish.

Open Software & Tools

This site wouldn’t be possible without the immense generosity and tireless efforts from the people who make contributions to the world and share their work via open source initiatives. Thank you 🙏

© 2026 – Pkg Stats / Ryan Hefner

peptoma-sdk

v0.1.3

Published

Official TypeScript SDK for the PEPTOMA open DeSci peptide research platform

Readme

peptoma-sdk

Official TypeScript / JavaScript SDK for the PEPTOMA open DeSci platform — AI-powered peptide sequence analysis, community peer-review, and on-chain research incentives on Solana.

npm version license types


Overview

PEPTOMA is an open decentralised science (DeSci) platform for peptide research. It combines proprietary PEPTOMA AI Engine analysis with a community peer-review system and on-chain Solana incentives.

This SDK gives developers programmatic access to every platform capability: sequence submission, feed retrieval, annotation, voting, API key management, and token data.


Installation

npm install peptoma-sdk
# or
pnpm add peptoma-sdk
# or
yarn add peptoma-sdk

Requirements: Node.js ≥ 18 (native fetch). Works in Bun and Deno environments as well.


Authentication

API keys are available to PRO (≥ 2,000 $PEPTM staked) and LAB (≥ 10,000 $PEPTM staked) tier wallets.

Generate your key from Mission Control → API Keys on the platform.

Keys follow the format pptm_<48-char-hex> and are passed automatically as a Bearer token by the client.

Security: Keys are shown only once at generation time. Store them in an environment variable or secret manager — never commit them to source control.


Quick Start

import { PeptomaClient } from "peptoma-sdk";

const client = new PeptomaClient({
  apiKey: process.env.PEPTOMA_API_KEY!, // pptm_...
});

// Analyze a peptide sequence
const result = await client.sequences.analyze({
  sequence: "KWLRRVWRPQKI",
  depth: "standard",        // "standard" | "deep"
  diseaseTarget: "MRSA",   // optional
});

console.log(result.bioactivityScore);  // 91
console.log(result.bioactivityLabel);  // "antimicrobial"
console.log(result.toxicityRisk);      // "low"
console.log(result.confidenceScore);   // 84

API Reference

new PeptomaClient(options)

| Option | Type | Required | Description | |-----------|----------|----------|--------------------------------------------------| | apiKey | string | Yes | Your PEPTOMA API key (pptm_...) | | baseUrl | string | No | Override base URL (default: https://peptoma.xyz/api) |


client.sequences

.analyze(options)Promise<SequenceAnalysis>

Submit a peptide sequence for AI analysis using the PEPTOMA AI Engine.

const result = await client.sequences.analyze({
  sequence: "KWLRRVWRPQKI",       // required — single-letter amino acid codes
  userId: "your_wallet_address",  // optional — links to your on-chain identity
  diseaseTarget: "MRSA",          // optional — organism or disease context
  notes: "AMP candidate",         // optional — research notes
  depth: "deep",                  // optional — "standard" (default) | "deep"
});

SequenceAnalysis response fields:

| Field | Type | Description | |------------------------|--------------------|----------------------------------------------------| | id | number | Unique sequence ID | | sequence | string | Input amino acid sequence | | status | string | "completed" | "processing" | "failed" | | bioactivityScore | number | Predicted bioactivity (0–100) | | bioactivityLabel | string | Class: "antimicrobial", "antiviral", "hormonal", etc. | | confidenceScore | number | Model confidence (0–100) | | structurePrediction | string | "alpha_helix" | "beta_sheet" | "random_coil" | "mixed" | | toxicityRisk | string | "low" | "medium" | "high" | | molecularWeight | number | Exact molecular weight (Da) — deterministic calc | | hydrophobicityIndex | number | Kyte-Doolittle GRAVY score | | chargeAtPH7 | number | Net charge at physiological pH | | halfLife | string | Estimated plasma half-life e.g. "~8h (s.c.)" | | tags | string[] | Auto-generated classification tags | | annotationSuggestions| string[] | AI-generated peer-review prompts for community | | voteCount | number | Community consensus vote count | | annotationCount | number | Total peer-review annotations | | diseaseTarget | string \| null | Supplied disease/organism target | | createdAt | string | ISO 8601 timestamp |

.get(id)Promise<SequenceAnalysis>

Retrieve a previously submitted sequence by numeric ID.

const result = await client.sequences.get(42);

client.feed

.list(options?)Promise<FeedResponse>

Fetch the public research feed with optional filtering and sorting.

const { items, total, page, totalPages } = await client.feed.list({
  limit: 20,               // results per page (default: 20)
  page: 1,                 // page number (default: 1)
  disease: "Cancer",       // filter by disease target
  minScore: 70,            // minimum bioactivity score
  sort: "score",           // "newest" | "score" | "annotations" | "trending"
});

FeedResponse fields:

| Field | Type | Description | |--------------|----------------------|---------------------------| | items | SequenceAnalysis[] | Sequences on this page | | total | number | Total matching sequences | | page | number | Current page | | totalPages | number | Total pages available |

.stats()Promise<FeedStats>

Platform-wide aggregate statistics.

const stats = await client.feed.stats();
// { totalAnalyses, avgBioactivityScore, avgConfidenceScore, totalAnnotations, totalVotes, recentActivity, diseaseBreakdown }

FeedStats fields:

| Field | Type | Description | |-----------------------|----------------------------|------------------------------------| | totalAnalyses | number | Total sequences analyzed | | avgBioactivityScore | number | Platform average bioactivity score | | avgConfidenceScore | number | Platform average confidence score | | totalAnnotations | number | Total community annotations | | totalVotes | number | Total consensus votes | | recentActivity | number | Analyses in last 24 hours | | diseaseBreakdown | DiseaseBreakdownItem[] | Count per disease target |

.trending()Promise<SequenceAnalysis[]>

Top 10 sequences ranked by community vote count.

const trending = await client.feed.trending();

client.annotations

.list(sequenceId)Promise<Annotation[]>

List all peer-review annotations for a given sequence.

const annotations = await client.annotations.list(42);

.create(options)Promise<Annotation>

Submit a peer-review annotation. Earns research points redeemable for $PEPTM.

const annotation = await client.annotations.create({
  sequenceId: 42,
  userId: "your_wallet_address",
  type: "confirm",              // see annotation types below
  content: "Consistent with APD entry #1824. Confirmed membrane-active AMP.",
});

Annotation types and research point rewards:

| Type | Points | Description | |-------------|--------|---------------------------------------------------------------| | confirm | +2 | Agree with the AI classification based on expertise or data | | challenge | +3 | Dispute the result with evidence, literature, or reasoning | | extend | +5 | Add a related sequence, supporting data, or additional analysis | | tag | +2 | Apply a disease or target label to improve discoverability |

.vote(annotationId, direction)Promise<VoteResult>

Upvote or downvote a peer annotation.

const { score } = await client.annotations.vote(7, "up"); // "up" | "down"
console.log(score); // updated vote score

client.keys

Manage API keys programmatically. All methods require the client to be initialised with a PRO or LAB tier key.

.list()Promise<ApiKey[]>

const keys = await client.keys.list();

.generate(options?)Promise<GenerateKeyResult>

const { key, id } = await client.keys.generate({ label: "CI pipeline" });
// key = "pptm_..." — displayed once, store securely

.revoke(id)Promise<{ success: boolean }>

await client.keys.revoke(3);

client.token

.balance(userId)Promise<TokenBalance>

const data = await client.token.balance("8PAdZPAEEaD5gfJxbC1fFp4q7cpCNHhz4ycQMdT8P8Lg");
// { userId, balance, stakedAmount, earnedTotal, spentTotal, stakingTier, solanaAddress }

TokenBalance fields:

| Field | Type | Description | |----------------|----------------|----------------------------------------------| | userId | string | Wallet address / user identifier | | balance | number | Current $PEPTM balance | | stakedAmount | number | Amount currently staked | | earnedTotal | number | Total ever earned from contributions | | spentTotal | number | Total spent on analysis runs | | stakingTier | string | "free" | "researcher" | "pro" | "lab" | | solanaAddress| string\|null | Linked on-chain Solana address |

.leaderboard()Promise<LeaderboardEntry[]>

const leaders = await client.token.leaderboard();
// [{ userId, username, totalTokensEarned, totalContributions, rank }, ...]

Rate Limits

| Tier | Staking Requirement | Sequences / Day | API Access | |--------------|---------------------|-----------------|------------| | FREE | None | 3 | No | | RESEARCHER | ≥ 500 $PEPTM | 20 | No | | PRO | ≥ 2,000 $PEPTM | Unlimited | Yes | | LAB | ≥ 10,000 $PEPTM | Unlimited | Yes |

Rate limits reset at midnight UTC. Exceeded limits return HTTP 429.


Error Handling

All methods throw a PeptomaError on non-2xx responses.

import { PeptomaClient } from "peptoma-sdk";
import type { PeptomaError } from "peptoma-sdk";

try {
  const result = await client.sequences.analyze({ sequence: "ACDEF", userId: "wallet" });
} catch (err) {
  const e = err as PeptomaError;

  switch (e.status) {
    case 400: console.error("Bad request:", e.message); break;
    case 401: console.error("Invalid API key"); break;
    case 403: console.error("Tier does not permit this action"); break;
    case 404: console.error("Resource not found"); break;
    case 429: console.error("Daily run limit reached — resets at midnight UTC"); break;
    default:  console.error("Server error:", e.status, e.body);
  }
}

PeptomaError properties:

| Property | Type | Description | |-----------|-----------|------------------------------| | message | string | Human-readable error message | | status | number | HTTP status code | | body | unknown | Raw response body |


Complete Example — Automated Screening Pipeline

import { PeptomaClient } from "peptoma-sdk";

const client = new PeptomaClient({ apiKey: process.env.PEPTOMA_API_KEY! });

const CANDIDATES = [
  { sequence: "KWLRRVWRPQKI",                             target: "MRSA" },
  { sequence: "GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK",  target: "E. coli" },
  { sequence: "ACDEFGHIKLMNPQRSTVWY",                      target: "Candida" },
];

async function runScreen() {
  console.log(`Screening ${CANDIDATES.length} candidates...`);

  const results = await Promise.all(
    CANDIDATES.map(({ sequence, target }) =>
      client.sequences.analyze({
        sequence,
        depth: "deep",
        diseaseTarget: target,
        userId: "pipeline_bot",
      })
    )
  );

  const hits = results.filter(
    r =>
      r.bioactivityScore >= 75 &&
      r.bioactivityLabel === "antimicrobial" &&
      r.toxicityRisk === "low" &&
      r.confidenceScore >= 70
  );

  console.log(`\n${hits.length} / ${results.length} passed quality filter:`);
  for (const hit of hits) {
    console.log(
      `  ✓ #${hit.id} — score: ${hit.bioactivityScore}, ` +
      `confidence: ${hit.confidenceScore}, target: ${hit.diseaseTarget}`
    );

    await client.annotations.create({
      sequenceId: hit.id,
      userId: "pipeline_bot",
      type: "confirm",
      content:
        `Automated deep screen pass — bioactivity ${hit.bioactivityScore}/100, ` +
        `confidence ${hit.confidenceScore}/100, toxicity: ${hit.toxicityRisk}.`,
    });
  }
}

runScreen().catch(console.error);

TypeScript Types

All types are exported from the package root — no separate @types package required.

import type {
  PeptomaClientOptions,
  SequenceAnalysis,
  AnalyzeOptions,
  AnalysisDepth,
  StructurePrediction,
  ToxicityRisk,
  StakingTier,
  SortOption,
  FeedOptions,
  FeedResponse,
  FeedStats,
  DiseaseBreakdownItem,
  Annotation,
  AnnotationType,
  CreateAnnotationOptions,
  VoteDirection,
  VoteResult,
  ApiKey,
  GenerateKeyOptions,
  GenerateKeyResult,
  TokenBalance,
  LeaderboardEntry,
  PeptomaError,
} from "peptoma-sdk";

Links

| Resource | URL | |---------------|--------------------------------------------------------------| | Platform | peptoma.xyz | | Documentation | peptoma.xyz/docs | | Feed | peptoma.xyz/feed | | Token CA | HopMHHPfSV2kWQLghKt6xR1oWbPRLA2UyxnKGoPpump | | X / Twitter | @Peptoma_xyz | | npm | npmjs.com/package/peptoma-sdk |


License

MIT © 2026 PEPTOMA Team